Proteintech, 67056-1-Ig, Tissue Factor/CD142 Monoclonal antibody

Size: 20ul / 150ul The Tissue Factor/CD142 (67056-1-Ig) by Proteintech is a Monoclonal antibody targeting Tissue Factor/CD142 in WB, IHC, ELISA applications with reactivity to human samples 67056-1-Ig targets Tissue Factor/CD142 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, human blood tissue Positive IHC detected in: human lung squamous cell cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27563 Product name: Recombinant human F3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 113-251 aa of BC011029 Sequence: GNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE Predict reactive species Full Name: coagulation factor III (thromboplastin, tissue factor) Calculated Molecular Weight: 295 aa, 33 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC011029 Gene Symbol: F3 Gene ID (NCBI): 2152 RRID: AB_2882367 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P13726 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.