Proteintech, 67075-1-Ig, Endoglin/CD105 Monoclonal antibody

Size: 20ul / 150ul The Endoglin/CD105 (67075-1-Ig) by Proteintech is a Monoclonal antibody targeting Endoglin/CD105 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 67075-1-Ig targets Endoglin/CD105 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HUVEC cells, human placenta tissue Positive IHC detected in: human breast cancer tissue, human liver cancer tissue, human placenta tissue, human renal cell carcinoma tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, human liver cancer tissue, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:10000-1:40000 Immunofluorescence (IF)-P: IF-P : 1:5000-1:20000 Background Information Endoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27837 Product name: Recombinant human Endoglin/CD105 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 33-221 aa of BC014271 Sequence: QPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHIL Predict reactive species Full Name: endoglin Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC014271 Gene Symbol: CD105 Gene ID (NCBI): 2022 RRID: AB_2882383 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.