Proteintech, 67088-1-Ig, SDC2 Monoclonal antibody

Size: 20ul / 150ul The SDC2 (67088-1-Ig) by Proteintech is a Monoclonal antibody targeting SDC2 in WB, IHC, ELISA applications with reactivity to Human samples 67088-1-Ig targets SDC2 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: L02 cells, HuH-7 cells, HepG2 cells, A549 cells, NCI-H1299 cells, Jurkat cells Positive IHC detected in: human liver cancer tissue, human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. 67088-1-Ig antibody detects the 19 and 22 kDa SDC2 isoforms as well as the 48 kDa dimeric protein in SDS-PAGE.(PMID: 18803305, 23297089, 30022330, 29945573) Specification Tested Reactivity: Human Cited Reactivity: human, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5739 Product name: Recombinant human SDC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-148 aa of BC049836 Sequence: SRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAA Predict reactive species Full Name: syndecan 2 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 19 kDa, 22 and 48 kDa GenBank Accession Number: BC049836 Gene Symbol: SDC2 Gene ID (NCBI): 6383 RRID: AB_2882395 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P34741 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.