Iright
BRAND / VENDOR: Proteintech

Proteintech, 67092-2-Ig, ASAH1 Monoclonal antibody

CATALOG NUMBER: 67092-2-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ASAH1 (67092-2-Ig) by Proteintech is a Monoclonal antibody targeting ASAH1 in WB, IF/ICC, ELISA applications with reactivity to human, rat, pig, rabbit samples 67092-2-Ig targets ASAH1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig liver tissue, pig brain tissue, rabbit brain tissue, rat brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information ASAH1, also named as AC, ACDase, Acid CDase, PHP32 and ASAH, belongs to the acid ceramidase family. ASAH1 is a lipid hydrolase that catalyzes the conversion of ceramide (cer) into sphingosine (SPH) and a free fatty acid. Mutation of ASAH1 will cause the Farber lipogranulomatosis (FL) which also known as Farber disease (FD). ASAH1 is highly expressed in Heart. And it is first synthesized as an 55-60 kDa precursor and subsequently processed to the mature, heterodimeric enzyme (40 + 13 kDa) in the endosomes/lysosomes. Specification Tested Reactivity: human, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28645 Product name: Recombinant human ASAH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-389 aa of BC016828 Sequence: MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW Predict reactive species Full Name: N-acylsphingosine amidohydrolase (acid ceramidase) 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44-55 kDa GenBank Accession Number: BC016828 Gene Symbol: ASAH1 Gene ID (NCBI): 427 RRID: AB_3085035 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13510 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924