Proteintech, 67120-1-Ig, INA Monoclonal antibody

Size: 20ul / 150ul The INA (67120-1-Ig) by Proteintech is a Monoclonal antibody targeting INA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67120-1-Ig targets INA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: fetal human brain tissue, rat cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information INA, also named as Alpha internexin, is a 66 kDa intermediate filament protein which is involved in the morphogenesis of neurons. INA is mainly expressed in various kinds of central and peripheral neurons from early development and highly expressed in neurodegenerative and neuronal death cells. The MW of INA ranges from 60 kDa in human, pig and mouse to 66 kDa in rat.(PMID: 29940892, 2201753) Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13655 Product name: Recombinant human INA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC006359 Sequence: MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR Predict reactive species Full Name: internexin neuronal intermediate filament protein, alpha Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC006359 Gene Symbol: INA Gene ID (NCBI): 9118 RRID: AB_2882423 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.