Proteintech, 67126-1-Ig, DDR2 Monoclonal antibody

Size: 20ul / 150ul The DDR2 (67126-1-Ig) by Proteintech is a Monoclonal antibody targeting DDR2 in WB, ELISA applications with reactivity to Human samples 67126-1-Ig targets DDR2 in WB, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information DDR2 (Discoidin domain receptor 2) belongs to the receptor tyrosine kinase (RTK) family and is activated by collagen-binding.DDR2 is implicated in several physiological and pathological processes, including wound healing, angiogenesis, ovulation, spermatogenesis, extracellular matrix (ECM) remodeling and fibrosis, and tumor progression (PMID: 25805889). Moreover, DDR2 is prominently present in the fibroblasts, smooth muscle cells, myofibroblasts, and chondrocytes (PMID: 37834343). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28340 Product name: Recombinant human DDR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 291-398 aa of NM_001014796 Sequence: MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT Predict reactive species Full Name: discoidin domain receptor tyrosine kinase 2 Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: NM_001014796 Gene Symbol: DDR2 Gene ID (NCBI): 4921 RRID: AB_2882426 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16832 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.