Proteintech, 67133-1-Ig, Filamin A Monoclonal antibody

Size: 20ul / 150ul The Filamin A (67133-1-Ig) by Proteintech is a Monoclonal antibody targeting Filamin A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67133-1-Ig targets Filamin A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, MCF-7 cells, human skeletal muscle tissue, U2OS cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, A431 cells Positive IHC detected in: human cervical cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FLNA encodes a 280 kDa widely expressed actin binding protein called filamin A which can crosslinks actin filaments and links actin filaments to membrane glycoproteins to form a three-dimensional network (PMID:29931263). And filamin A could interact with many other proteins, involved in receptor activation, cell migration and adhesion, cell proliferation, inflammation and tumorigenesis, studies have been reported that FLNA overexpressed in multiple types of tumors, suggesting FLNA may involved in cancer aggressiveness(PMID:29100390). What's more, FLNA is an causative gene of periventricular nodular heterotopia (PNH) (PMID: 29062687) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23291 Product name: Recombinant human FLNA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2348-2647 aa of BC014654 Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP Predict reactive species Full Name: filamin A, alpha (actin binding protein 280) Calculated Molecular Weight: 2647 aa, 280 kDa Observed Molecular Weight: 280 kDa GenBank Accession Number: BC014654 Gene Symbol: FLNA Gene ID (NCBI): 2316 RRID: AB_2882432 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21333 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.