Proteintech, 67134-1-Ig, VILIP1 Monoclonal antibody

Size: 20ul / 150ul The VILIP1 (67134-1-Ig) by Proteintech is a Monoclonal antibody targeting VILIP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67134-1-Ig targets VILIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4923 Product name: Recombinant human VSNL1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-191 aa of BC022012 Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK Predict reactive species Full Name: visinin-like 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC022012 Gene Symbol: VSNL1 Gene ID (NCBI): 7447 RRID: AB_2882433 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P62760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.