Iright
BRAND / VENDOR: Proteintech

Proteintech, 67143-1-Ig, RIAM Monoclonal antibody

CATALOG NUMBER: 67143-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RIAM (67143-1-Ig) by Proteintech is a Monoclonal antibody targeting RIAM in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse samples 67143-1-Ig targets RIAM in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells, Raji cells, mouse brain tissue, Jurkat cells, Ramos cells, Dauli cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information APBB1IP gene encodes a Rap1-GTP-interacting adapter molecule (RIAM) which is an important protein in Rap1-mediated integrin activation and adhesion. Rap1 is a small GTPase frequently activated in tumors such as melanoma and prostate cancer. RIAM is widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes. RIAM may function in the signal transduction from Ras activation to actin cytoskeletal remodeling. The observed molecular weight of RIAM is about 100 kDa. Specification Tested Reactivity: Human, Mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4602 Product name: Recombinant human RIAM,APBB1IP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-172 aa of BC035636 Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP Predict reactive species Full Name: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein Calculated Molecular Weight: 666 aa, 73 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC035636 Gene Symbol: RIAM Gene ID (NCBI): 54518 RRID: AB_2882442 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7Z5R6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924