Iright
BRAND / VENDOR: Proteintech

Proteintech, 67180-1-Ig, IRAK4 Monoclonal antibody

CATALOG NUMBER: 67180-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IRAK4 (67180-1-Ig) by Proteintech is a Monoclonal antibody targeting IRAK4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67180-1-Ig targets IRAK4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, THP-1 cells, K-562 cells Positive IHC detected in: human placenta tissue, mouse kidney tissue, mouse pancreas tissue, rat pancreas tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29174 Product name: Recombinant human IRAK4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC013316 Sequence: MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV Predict reactive species Full Name: interleukin-1 receptor-associated kinase 4 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC013316 Gene Symbol: IRAK4 Gene ID (NCBI): 51135 RRID: AB_2882476 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NWZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924