Iright
BRAND / VENDOR: Proteintech

Proteintech, 67194-2-Ig, SHC1 Monoclonal antibody

CATALOG NUMBER: 67194-2-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SHC1 (67194-2-Ig) by Proteintech is a Monoclonal antibody targeting SHC1 in WB, ELISA applications with reactivity to human samples 67194-2-Ig targets SHC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TT cells, hTERT-RPE1 cells, PANC-1 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The proto-oncogene SHC family consists of SHCA, SHCB, SHCC, and SHCD4 gene members, which can encode 7 kinds of cohesive molecules. SHC family is widely expressed and functional. The SHC1 gene is located in zone 1, region 2 of human chromosome 1. SHC1 is believed to be involved in inhibiting neuronal apoptosis and regulating the receptor tyrosine kinase pathway. SHC1 sensitizes cancer cells to the 8-Cl-cAMP treatment. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25173 Product name: Recombinant human SHC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of NM_183001 Sequence: MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGC Predict reactive species Full Name: SHC (Src homology 2 domain containing) transforming protein 1 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: NM_183001 Gene Symbol: SHC1 Gene ID (NCBI): 6464 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29353 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924