Iright
BRAND / VENDOR: Proteintech

Proteintech, 67198-1-Ig, UBE1 Monoclonal antibody

CATALOG NUMBER: 67198-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UBE1 (67198-1-Ig) by Proteintech is a Monoclonal antibody targeting UBE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67198-1-Ig targets UBE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HeLa cell, HEK-293 cells, Jurkat cells, HL-60 cells, K-562 cells, HSC-T6 cells, RAW 264.7 cells, NIH/3T3 cells Positive IHC detected in: human colon cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:30000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8920 Product name: Recombinant human UBE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 711-1058 aa of BC013041 Sequence: CHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR Predict reactive species Full Name: ubiquitin-like modifier activating enzyme 1 Calculated Molecular Weight: 1058 aa, 118 kDa Observed Molecular Weight: 114-118 kDa GenBank Accession Number: BC013041 Gene Symbol: UBA1 Gene ID (NCBI): 7317 RRID: AB_2882491 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22314 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924