Iright
BRAND / VENDOR: Proteintech

Proteintech, 67206-1-Ig, SQLE Monoclonal antibody

CATALOG NUMBER: 67206-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SQLE (67206-1-Ig) by Proteintech is a Monoclonal antibody targeting SQLE in WB, IF/ICC, ELISA applications with reactivity to human, rat, pig samples 67206-1-Ig targets SQLE in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HepG2 cells, HSC-T6 cells, L02 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SQLE, also named as ERG1, SE and SM, belongs to the squalene monooxygenase family. It catalyzes the first oxygenation step in cholesterol synthesis, acting on squalene before cyclization into the basic steroid structure. SQLE may serve as a flux-controlling enzyme beyond 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR, considered as rate limiting). It is also posttranslationally regulated by cholesterol-dependent proteasomal degradation. SQLE is subject to feedback regulation via cholesterol-induced degradation, which depends on its lipid-sensing N terminal regulatory domain. Truncation of SQLE occurs during its endoplasmic reticulum-associated degradation and requires the proteasome, which partially degrades the SQLE N-terminus and eliminates cholesterol-sensing elements within this region. The MW of SQLE is about 50-64 kDa. (PMID:21356516, PMID: 28972164) Specification Tested Reactivity: human, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3266 Product name: Recombinant human SQLE protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 143-508 aa of BC017033 Sequence: SRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKVSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGGMTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGECVAGPVGL Predict reactive species Full Name: squalene epoxidase Calculated Molecular Weight: 574 aa, 64 kDa Observed Molecular Weight: 50-64 kDa GenBank Accession Number: BC017033 Gene Symbol: SQLE Gene ID (NCBI): 6713 RRID: AB_2882499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924