Proteintech, 67219-1-Ig, VAMP4 Monoclonal antibody

Size: 20ul / 150ul The VAMP4 (67219-1-Ig) by Proteintech is a Monoclonal antibody targeting VAMP4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67219-1-Ig targets VAMP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information VAMP4 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP4 may play a role in trans-Golgi network to endosome transport. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27854 Product name: Recombinant human VAMP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC007019 Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT Predict reactive species Full Name: vesicle-associated membrane protein 4 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC007019 Gene Symbol: VAMP4 Gene ID (NCBI): 8674 RRID: AB_2882510 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75379 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.