Proteintech, 67220-1-Ig, LAIR1 Monoclonal antibody

Size: 20ul / 150ul The LAIR1 (67220-1-Ig) by Proteintech is a Monoclonal antibody targeting LAIR1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 67220-1-Ig targets LAIR1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells, TF-1 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14459 Product name: Recombinant human LAIR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 184-287 aa of BC027899 Sequence: FCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH Predict reactive species Full Name: leukocyte-associated immunoglobulin-like receptor 1 Calculated Molecular Weight: 287 aa, 31 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC027899 Gene Symbol: LAIR1 Gene ID (NCBI): 3903 RRID: AB_2882511 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6GTX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.