Proteintech, 67239-1-Ig, CDC27; APC3 Monoclonal antibody

Size: 20ul / 150ul The CDC27; APC3 (67239-1-Ig) by Proteintech is a Monoclonal antibody targeting CDC27; APC3 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67239-1-Ig targets CDC27; APC3 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, HSC-T6 cells, 4T1 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lung cancer tissue Positive IF/ICC detected in: HEK-293 cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CDC27/APC3 is a component of the anaphase-promoting complex (APC/cyclosome), which is composed of eight subunits and highly conserved in eukaryotic cells. The APC/cyclosome complex acts as a cell cycle-regulated E3 ubiquitin ligase which mediates ubiquitination and subsequent degradation of target proteins, and lead to the progression control through mitosis and the G1 phase of the cell cycle. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25588 Product name: Recombinant human CDC27; APC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-830 aa of BC011656 Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF Predict reactive species Full Name: cell division cycle 27 homolog (S. cerevisiae) Calculated Molecular Weight: 92 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC011656 Gene Symbol: CDC27 Gene ID (NCBI): 996 RRID: AB_2882518 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30260 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.