Product Description
Size: 20ul / 150ul
The CD300a (67242-1-Ig) by Proteintech is a Monoclonal antibody targeting CD300a in WB, ELISA applications with reactivity to human samples
67242-1-Ig targets CD300a in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: THP-1 cells, HL-60 cells, human spleen tissue, Jurkat cells, K-562 cells, Raji cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag5776 Product name: Recombinant human CD300A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-141 aa of BC032352 Sequence: CRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKT Predict reactive species
Full Name: CD300a molecule
Calculated Molecular Weight: 299 aa, 33 kDa
Observed Molecular Weight: 50-60 kDa
GenBank Accession Number: BC032352
Gene Symbol: CD300a
Gene ID (NCBI): 11314
RRID: AB_2882521
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q9UGN4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924