Iright
BRAND / VENDOR: Proteintech

Proteintech, 67242-1-Ig, CD300a Monoclonal antibody

CATALOG NUMBER: 67242-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD300a (67242-1-Ig) by Proteintech is a Monoclonal antibody targeting CD300a in WB, ELISA applications with reactivity to human samples 67242-1-Ig targets CD300a in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells, human spleen tissue, Jurkat cells, K-562 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5776 Product name: Recombinant human CD300A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-141 aa of BC032352 Sequence: CRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKT Predict reactive species Full Name: CD300a molecule Calculated Molecular Weight: 299 aa, 33 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC032352 Gene Symbol: CD300a Gene ID (NCBI): 11314 RRID: AB_2882521 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UGN4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924