Proteintech, 67243-1-Ig, MYH10 Monoclonal antibody

Size: 20ul / 150ul The MYH10 (67243-1-Ig) by Proteintech is a Monoclonal antibody targeting MYH10 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples 67243-1-Ig targets MYH10 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, rat cerebellum tissue, mouse cerebellum tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information MYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17069 Product name: Recombinant human MYH10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1183-1322 aa of BC150634 Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL Predict reactive species Full Name: myosin, heavy chain 10, non-muscle Calculated Molecular Weight: 1985 aa, 230 kDa Observed Molecular Weight: 200-230 kDa GenBank Accession Number: BC150634 Gene Symbol: MYH10 Gene ID (NCBI): 4628 RRID: AB_2882522 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35580 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.