Proteintech, 67244-1-Ig, TPM4 Monoclonal antibody

Size: 20ul / 150ul The TPM4 (67244-1-Ig) by Proteintech is a Monoclonal antibody targeting TPM4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67244-1-Ig targets TPM4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue, A549 cells, HeLa cells, HepG2 cells, mouse skeletal muscle tissue, rabbit skeletal muscle tissue, rat heart tissue, mouse heart tissue, rabbit heart tissue, HT-29 cells, human heart tissue, pig heart tissue Positive IHC detected in: mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TPM4 is a member of tropomyosins (TPMs), a multi-gene family of actin-binding proteins present in all eukaryotic cells. In muscle, TPMs are responsible for mediating contraction via regulation of the actin-myosin interaction. As to non-muscle cells, its proposed role is to stabilize the actin filaments by modulating the interaction with proteins that are responsible for the regulation of actin dynamics. The form of TPM4 in muscle has a higher molecular weight than the form found in non-muscle cells. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6947 Product name: Recombinant human TPM4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI Predict reactive species Full Name: tropomyosin 4 Calculated Molecular Weight: 248 aa, 29 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC037576 Gene Symbol: TPM4 Gene ID (NCBI): 7171 ENSEMBL Gene ID: ENSG00000167460 RRID: AB_2882523 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P67936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.