Product Description
Size: 20ul / 150ul
The P glycoprotein (67258-2-Ig) by Proteintech is a Monoclonal antibody targeting P glycoprotein in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
67258-2-Ig targets P glycoprotein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: unboiled HeLa cells, unboiled HepG2 cells, SH-SY5Y cells
Positive IHC detected in: human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: COLO 320 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Background Information
ABCB1 (also known as P-gp/ P-glycoprotein, MDR1/multidrug-resistance 1) is a plasma membrane protein first discovered in multidrug resistant tumor cells. ABCB1 can extrude a large number of medically relevant compounds from cells and causes drug resistance. ABCB1 is expressed in a variety of human cancers as well as normal tissues including brain, and placenta. Overexpression of ABCB1 correlates with a negative prognosis in several types of cancer. For optimal WB detection, we recommend to avoid boiling the sample after lysis.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag17811 Product name: Recombinant human ABCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 624-708 aa of BC130424 Sequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW Predict reactive species
Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 1
Calculated Molecular Weight: 1280 aa, 142 kDa
Observed Molecular Weight: 130-150 kDa
GenBank Accession Number: BC130424
Gene Symbol: P glycoprotein
Gene ID (NCBI): 5243
RRID: AB_3085039
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: P08183
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924