Product Description
Size: 20ul / 150ul
The VANGL2 (67273-1-Ig) by Proteintech is a Monoclonal antibody targeting VANGL2 in WB, ELISA applications with reactivity to Human samples
67273-1-Ig targets VANGL2 in WB, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, HepG2 cells, HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.
Specification
Tested Reactivity: Human
Cited Reactivity: hamster
Host / Isotype: Mouse / IgG3
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag16980 Product name: Recombinant human VANGL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species
Full Name: vang-like 2 (van gogh, Drosophila)
Calculated Molecular Weight: 521 aa, 60 kDa
Observed Molecular Weight: 60 kDa
GenBank Accession Number: BC103920
Gene Symbol: VANGL2
Gene ID (NCBI): 57216
RRID: AB_2882542
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q9ULK5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924