Iright
BRAND / VENDOR: Proteintech

Proteintech, 67279-1-Ig, ARF5 Monoclonal antibody

CATALOG NUMBER: 67279-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARF5 (67279-1-Ig) by Proteintech is a Monoclonal antibody targeting ARF5 in WB, ELISA applications with reactivity to Human, mouse, rat, pig samples 67279-1-Ig targets ARF5 in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, pig brain tissue, rat brain tissue, mouse brain tissue, HeLa cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7849 Product name: Recombinant human ARF5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of BC003043 Sequence: MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR Predict reactive species Full Name: ADP-ribosylation factor 5 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC003043 Gene Symbol: ARF5 Gene ID (NCBI): 381 RRID: AB_2882547 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P84085 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924