Iright
BRAND / VENDOR: Proteintech

Proteintech, 67284-1-Ig, Ins1 Monoclonal antibody

CATALOG NUMBER: 67284-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Ins1 (67284-1-Ig) by Proteintech is a Monoclonal antibody targeting Ins1 in IHC, IF-P, ELISA applications with reactivity to Rat, mouse samples 67284-1-Ig targets Ins1 in IHC, IF-P, ELISA applications and shows reactivity with Rat, mouse samples. Tested Applications Positive IHC detected in: rat pancreas tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:5000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: Rat, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28809 Product name: Recombinant rat Insulin1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-87 aa of NM_019129.3 Sequence: MFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVAR Predict reactive species Full Name: insulin 1 Calculated Molecular Weight: 12 kDa GenBank Accession Number: NM_019129.3 Gene Symbol: Ins1 Gene ID (NCBI): 24505 RRID: AB_2882551 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01322 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924