Product Description
Size: 20ul / 150ul
The ERN2 (67289-1-Ig) by Proteintech is a Monoclonal antibody targeting ERN2 in WB, IHC, ELISA applications with reactivity to Human samples
67289-1-Ig targets ERN2 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: JAR cells, A549 cells
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: Human
Host / Isotype: Mouse / IgG2a
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag29452 Product name: Recombinant human ERN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 452-563 aa of BC157113 Sequence: SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV Predict reactive species
Full Name: endoplasmic reticulum to nucleus signaling 2
Observed Molecular Weight: 102 kDa
GenBank Accession Number: BC157113
Gene Symbol: ERN2
Gene ID (NCBI): 10595
RRID: AB_2882555
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q76MJ5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924