Iright
BRAND / VENDOR: Proteintech

Proteintech, 67291-1-Ig, WFS1 Monoclonal antibody

CATALOG NUMBER: 67291-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WFS1 (67291-1-Ig) by Proteintech is a Monoclonal antibody targeting WFS1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 67291-1-Ig targets WFS1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, A172 cells, HT-29 cells, HEK-293 cells, C6 cells, U-251 cells, PC-12 cells, Neuro-2a cells, SW480 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Wolfram syndrome protein (WFS1), also called wolframin, is a transmembrane protein, which is located primarily in the endoplasmic reticulum and its expression is induced in response to ER stress, partially through transcriptional activation. ER localization suggests that WFS1 protein has physiological functions in membrane trafficking, secretion, processing and/or regulation of ER calcium homeostasis. It is ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations of the WFS1 gene are responsible for two hereditary diseases, autosomal recessive Wolfram syndrome and autosomal dominant low frequency sensorineural hearing loss. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25735 Product name: Recombinant human WFS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC030130 Sequence: MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA Predict reactive species Full Name: Wolfram syndrome 1 (wolframin) Calculated Molecular Weight: 890 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC030130 Gene Symbol: WFS1 Gene ID (NCBI): 7466 RRID: AB_2882556 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O76024 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924