Iright
BRAND / VENDOR: Proteintech

Proteintech, 67292-1-Ig, PRLR Monoclonal antibody

CATALOG NUMBER: 67292-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PRLR (67292-1-Ig) by Proteintech is a Monoclonal antibody targeting PRLR in WB, IHC, ELISA applications with reactivity to human, mouse samples 67292-1-Ig targets PRLR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, T-47D cells, 4T1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:500 Background Information PRLR belongs to the cytokine type I subfamily, which also includes receptors for leptin, leukemia inhibiting factor, erythropoietin and so on. PRLR has long and short forms at approximately 70 and 45 kDa, respectively, and the mature, glycosylated form of PRLR migrates at 85-95 kDa in human decidua and placenta (PMID: 18258683). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28778 Product name: Recombinant human PRLR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-622 aa of BC059392 Sequence: EELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH Predict reactive species Full Name: prolactin receptor Calculated Molecular Weight: 622 aa, 70 kDa Observed Molecular Weight: 85-95 kDa GenBank Accession Number: BC059392 Gene Symbol: PRLR Gene ID (NCBI): 5618 RRID: AB_2882557 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924