Proteintech, 67294-1-Ig, GNMT Monoclonal antibody

Size: 20ul / 150ul The GNMT (67294-1-Ig) by Proteintech is a Monoclonal antibody targeting GNMT in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67294-1-Ig targets GNMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: rat liver tissue, pig liver tissue, mouse liver tissue, rat pancreas tissue, mouse pancreas tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Glycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4598 Product name: Recombinant human GNMT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-295 aa of BC032627 Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD Predict reactive species Full Name: glycine N-methyltransferase Calculated Molecular Weight: 295 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC032627 Gene Symbol: GNMT Gene ID (NCBI): 27232 RRID: AB_2882559 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.