Product Description
Size: 20ul / 150ul
The TRAF2 (67315-1-Ig) by Proteintech is a Monoclonal antibody targeting TRAF2 in WB, IF/ICC, ELISA applications with reactivity to Human samples
67315-1-Ig targets TRAF2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, THP-1 cells, K-562 cells, Jurkat cells, L02 cells, HEK-293 cells
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
Specification
Tested Reactivity: Human
Cited Reactivity: human, mouse
Host / Isotype: Mouse / IgG2a
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species
Full Name: TNF receptor-associated factor 2
Calculated Molecular Weight: 56 kDa
Observed Molecular Weight: 53 kDa
GenBank Accession Number: BC032410
Gene Symbol: TRAF2
Gene ID (NCBI): 7186
RRID: AB_2882575
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q12933
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924