Iright
BRAND / VENDOR: Proteintech

Proteintech, 67315-1-Ig, TRAF2 Monoclonal antibody

CATALOG NUMBER: 67315-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRAF2 (67315-1-Ig) by Proteintech is a Monoclonal antibody targeting TRAF2 in WB, IF/ICC, ELISA applications with reactivity to Human samples 67315-1-Ig targets TRAF2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, THP-1 cells, K-562 cells, Jurkat cells, L02 cells, HEK-293 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species Full Name: TNF receptor-associated factor 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC032410 Gene Symbol: TRAF2 Gene ID (NCBI): 7186 RRID: AB_2882575 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q12933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924