Proteintech, 67329-1-Ig, GSK3B Monoclonal antibody

Size: 20ul / 150ul The GSK3B (67329-1-Ig) by Proteintech is a Monoclonal antibody targeting GSK3B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 67329-1-Ig targets GSK3B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: A549 cells, pig brain tissue, HEK-293 cells, LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, MOLT-4 Positive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase .GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution . Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species Full Name: glycogen synthase kinase 3 beta Calculated Molecular Weight: 433 aa, 48 kDa Observed Molecular Weight: 46-48 kDa GenBank Accession Number: BC000251 Gene Symbol: GSK3B Gene ID (NCBI): 2932 RRID: AB_2882588 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49841 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.