Proteintech, 67348-1-Ig, ANAPC5 Monoclonal antibody

Size: 20ul / 150ul The ANAPC5 (67348-1-Ig) by Proteintech is a Monoclonal antibody targeting ANAPC5 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples 67348-1-Ig targets ANAPC5 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7409 Product name: Recombinant human ANAPC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-343 aa of BC001081 Sequence: MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHC Predict reactive species Full Name: anaphase promoting complex subunit 5 Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 85 kDa, 72 kDa GenBank Accession Number: BC001081 Gene Symbol: ANAPC5 Gene ID (NCBI): 51433 RRID: AB_2882606 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UJX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.