Proteintech, 67363-1-Ig, NHE1 Monoclonal antibody

Size: 20ul / 150ul The NHE1 (67363-1-Ig) by Proteintech is a Monoclonal antibody targeting NHE1 in WB, ELISA applications with reactivity to human, rat samples 67363-1-Ig targets NHE1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, NCI-H1299 cells, HEK-293 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NHE1, also named as SLC9A1, is involved in pH regulation that can eliminate acids generated by active metabolism and counter adverse environmental conditions. NHE1 plays an important role in signal transduction. It has been shown that NHE1 participates in the development and progression of human breast cancer, gastric cancer and others. NHE1 has some isoforms with 91 kDa , 110 kDa (phosphoglycoprotein) and 210 kDa (dimeric protein). (PMID:28098891, 27751915, 8300588) Specification Tested Reactivity: human, rat Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14329 Product name: Recombinant human NHE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-108 aa of BC012121 Sequence: MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW Predict reactive species Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 1 Calculated Molecular Weight: 815 aa, 91 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC012121 Gene Symbol: NHE1 Gene ID (NCBI): 6548 RRID: AB_2882615 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P19634 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.