Proteintech, 67369-1-Ig, PNPLA3 Monoclonal antibody

Size: 20ul / 150ul The PNPLA3 (67369-1-Ig) by Proteintech is a Monoclonal antibody targeting PNPLA3 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Rat, pig samples 67369-1-Ig targets PNPLA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, SMMC-7721 cells, HuH-7 cells, HSC-T6 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PNPLA3 belongs to a family of proteins that share a domain that was first identified in patatin, a major soluble protein of potato tubers with nonspecific acyl hydrolase activity. The domain differs from classical lipases by employing a catalytic dyad (Ser-Asp), rather than a catalytic triad, to effect hydrolysis. PNPLA3 is expressed primarily in liver and adipose tissue, in which it partitions to membranes and lipid droplets. Real-time PCR of cDNA from human tissues indicated that PNPLA3 expression was highest in the liver, followed by skin and adipose tissue. PNPLA3 is expressed at the highest levels in adipose tissue of mice. The PNPLA3 protein was expected at 50-70 kDa, as observed; the additional band at approximately 130-150 kDa is a oligomer bands. (PMID: 20385813, PMID: 24931521, PMID: 23023705) Specification Tested Reactivity: Human, Rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27407 Product name: Recombinant human PNPLA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 229-339 aa of BC065195 Sequence: PDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYM Predict reactive species Full Name: patatin-like phospholipase domain containing 3 Observed Molecular Weight: 53 kDa GenBank Accession Number: BC065195 Gene Symbol: PNPLA3 Gene ID (NCBI): 80339 RRID: AB_2882619 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NST1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.