Iright
BRAND / VENDOR: Proteintech

Proteintech, 67379-1-Ig, SEC11A Monoclonal antibody

CATALOG NUMBER: 67379-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SEC11A (67379-1-Ig) by Proteintech is a Monoclonal antibody targeting SEC11A in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 67379-1-Ig targets SEC11A in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SEC11A(Signal peptidase complex catalytic subunit SEC11A) is also named as SEC11L1, SPC18, SPCS4A and belongs to the peptidase S26B family. It is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. SEC11A has some isoforms with the molecular mass of 17-21 kDa. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6610 Product name: Recombinant human SEC11A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of BC000359 Sequence: MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE Predict reactive species Full Name: SEC11 homolog A (S. cerevisiae) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 17-21 kDa GenBank Accession Number: BC000359 Gene Symbol: SEC11A Gene ID (NCBI): 23478 RRID: AB_2882626 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P67812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924