Proteintech, 67389-1-Ig, ZG16 Monoclonal antibody

Size: 20ul / 150ul The ZG16 (67389-1-Ig) by Proteintech is a Monoclonal antibody targeting ZG16 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig samples 67389-1-Ig targets ZG16 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse colon tissue, human colon tissue, pig colon tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue Positive IF-Fro detected in: mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Background Information Zymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569) Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11332 Product name: Recombinant human ZG16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-167 aa of BC029149 Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC Predict reactive species Full Name: zymogen granule protein 16 homolog (rat) Calculated Molecular Weight: 167 aa, 18 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC029149 Gene Symbol: ZG16 Gene ID (NCBI): 653808 RRID: AB_2882633 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O60844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.