Proteintech, 67414-1-Ig, GRIM19 Monoclonal antibody

Size: 20ul / 150ul The GRIM19 (67414-1-Ig) by Proteintech is a Monoclonal antibody targeting GRIM19 in WB, IHC, ELISA applications with reactivity to human samples 67414-1-Ig targets GRIM19 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family.t GRIM-19 may distribute in the mitochondria and/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20855 Product name: Recombinant human GRIM19 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-144 aa of BC009189 Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 Calculated Molecular Weight: 16.5 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC009189 Gene Symbol: GRIM19 Gene ID (NCBI): 51079 RRID: AB_2882654 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9P0J0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.