Proteintech, 67415-1-Ig, Cyclin C Monoclonal antibody

Size: 20ul / 150ul The Cyclin C (67415-1-Ig) by Proteintech is a Monoclonal antibody targeting Cyclin C in WB, ELISA applications with reactivity to Human, mouse, rat samples 67415-1-Ig targets Cyclin C in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, LNCaP cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23955 Product name: Recombinant human CCNC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-283 aa of BC056153 Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS Predict reactive species Full Name: cyclin C Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC056153 Gene Symbol: Cyclin C Gene ID (NCBI): 892 RRID: AB_2882655 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24863 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.