Iright
BRAND / VENDOR: Proteintech

Proteintech, 67416-1-Ig, ERO1L Monoclonal antibody

CATALOG NUMBER: 67416-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ERO1L (67416-1-Ig) by Proteintech is a Monoclonal antibody targeting ERO1L in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67416-1-Ig targets ERO1L in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human pancreas cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human stomach cancer tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ERO1L, also named as ERO1-alpha, is an essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. It acts by oxidizing directly P4HB/PDI isomerase through a direct disulfide exchange. It does not act as a direct oxidant of folding substrate, but relies on P4HB/PDI to transfer oxidizing equivalent. Associates with ERP44 but not with GRP54, demonstrating that it does not oxidize all PDI related proteins and can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Glutathione may be required to regulate its activity in the endoplasmic reticulum. It may be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress. It is required for the folding of immunoglobulin proteins. Responsible for the release of the unfolded cholera toxin from reduced P4HB/PDI in case of infection by V.cholerae, thereby playing a role in retrotranslocation of the toxin. ERO1L has a calculated molecular weight of 54 kDa and can be detected as 60kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29910 Product name: Recombinant human ERO1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-390 aa of BC008674 Sequence: SGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMD Predict reactive species Full Name: ERO1-like (S. cerevisiae) Calculated Molecular Weight: 468 aa, 54 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC008674 Gene Symbol: ERO1L Gene ID (NCBI): 30001 RRID: AB_2882656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96HE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924