Iright
BRAND / VENDOR: Proteintech

Proteintech, 67417-1-Ig, ACVR1 Monoclonal antibody

CATALOG NUMBER: 67417-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ACVR1 (67417-1-Ig) by Proteintech is a Monoclonal antibody targeting ACVR1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Pig, Mouse, Rat samples 67417-1-Ig targets ACVR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples. Tested Applications Positive WB detected in: pig brain tissue, rat brain tissue, NCI-H1299 cells, mouse brain tissue, JAR cells Positive IHC detected in: mouse heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017). Specification Tested Reactivity: Human, Pig, Mouse, Rat Cited Reactivity: human, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13508 Product name: Recombinant human ACVR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 210-509 aa of BC033867 Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Predict reactive species Full Name: activin A receptor, type I Calculated Molecular Weight: 509 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC033867 Gene Symbol: ACVR1 Gene ID (NCBI): 90 RRID: AB_2882657 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924