Iright
BRAND / VENDOR: Proteintech

Proteintech, 67418-1-Ig, CDCA5 Monoclonal antibody

CATALOG NUMBER: 67418-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDCA5 (67418-1-Ig) by Proteintech is a Monoclonal antibody targeting CDCA5 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67418-1-Ig targets CDCA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human lung cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human cell division cycle associated 5 (CDCA5), also known as Sororin, is required for stable binding of cohesin to chromatid in the S and G2/M phases and degraded through anaphase-promoting complex-dependent ubiquitination in the G0/G1 phase (PMID: 30808873). Suppression of CDCA5 expression with siRNAs inhibited the growth of lung cancer cells. CDCA5 positivity is an independent prognostic factor for lung cancer patients (PMID: 20551060). The predicted molecular size of CDCA is 27 kd, with an electrophoretic mobility of ~35 kd on SDS-PAGE, possibly due to its isoelectric point (pI) of approximately 10 (PMID: 22580470). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28958 Product name: Recombinant human CDCA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-252 aa of BC011000 Sequence: MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE Predict reactive species Full Name: cell division cycle associated 5 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27~35 kDa GenBank Accession Number: BC011000 Gene Symbol: CDCA5 Gene ID (NCBI): 113130 RRID: AB_2882658 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96FF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924