Proteintech, 67421-1-Ig, CYP21A2 Monoclonal antibody

Size: 20ul / 150ul The CYP21A2 (67421-1-Ig) by Proteintech is a Monoclonal antibody targeting CYP21A2 in WB, IF/ICC, ELISA applications with reactivity to human, pig samples 67421-1-Ig targets CYP21A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HepG2 cells, human adrenal gland tissue, PC-12 cells, pig adrenal gland tissue Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species Full Name: cytochrome P450, family 21, subfamily A, polypeptide 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 53-56 kDa GenBank Accession Number: NM_000500 Gene Symbol: CYP21A2 Gene ID (NCBI): 1589 RRID: AB_2882661 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.