Iright
BRAND / VENDOR: Proteintech

Proteintech, 67424-1-Ig, CD72 Monoclonal antibody

CATALOG NUMBER: 67424-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD72 (67424-1-Ig) by Proteintech is a Monoclonal antibody targeting CD72 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 67424-1-Ig targets CD72 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, Ramos cells Positive IF/ICC detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:800-1:3200 Background Information CD72 is a type II transmembrane glycoprotein of 39-45 kDa and is expressed as a disulphide-linked homodimer (PMID: 1711157). CD72 is a pan B-cell marker covering the full range of differentiation from the very early stages of B cells to mature surface Ig+ B cells (PMID: 1384316). It is expressed in all stages of B cell development except plasma cells. CD72 is also expressed by dendritic cells, tissue macrophages in the red pulp of the spleen and von Kupffer cells in the liver (PMID: 8561576; 1384316). CD72 is the ligand for CD5 (PMID: 1711157). CD72 is a negative regulator of BCR signaling (PMID: 9590210). Interaction of CD100 with CD72 strictly tunes the strength of BCR signals and is essential for maintaining immunological homeostasis as well as generating a proper immune response (PMID: 16113236). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14405 Product name: Recombinant human CD72 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 116-359 aa of BC030227 Sequence: VRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD Predict reactive species Full Name: CD72 molecule Calculated Molecular Weight: 359 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC030227 Gene Symbol: CD72 Gene ID (NCBI): 971 RRID: AB_2882663 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21854 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924