Iright
BRAND / VENDOR: Proteintech

Proteintech, 67425-1-Ig, Sam50 Monoclonal antibody

CATALOG NUMBER: 67425-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Sam50 (67425-1-Ig) by Proteintech is a Monoclonal antibody targeting Sam50 in IF/ICC, ELISA applications with reactivity to human samples 67425-1-Ig targets Sam50 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Sam50, encoded by the SAMM50 gene, is an essential protein of the mitochondrial outer membrane (OMM). It contains a beta-barrel domain conserved from bacteria to man (PMID: 14570913). Sam50 is a part of the sorting and assembly machinery (SAM) necessary for the assembly of beta-barrel proteins in the OMM (PMID: 22252321). It is crucial for maintaining mitochondrial shape, morphology of mitochondrial cristae, and assembly of the mitochondrial respiratory chain complexes (PMID: 26587038; 22252321; 25781180). Polymorphisms in the SAMM50 gene have been associated with development and progression of nonalcoholic fatty liver disease (PMID: 23535911). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15155 Product name: Recombinant human SAMM50 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 119-468 aa of BC007830 Sequence: TFEVTELRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSVRGFSMHSIGPQSEGDYLGGEAYWAGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL Predict reactive species Full Name: sorting and assembly machinery component 50 homolog (S. cerevisiae) Calculated Molecular Weight: 469 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC007830 Gene Symbol: Sam50 Gene ID (NCBI): 25813 RRID: AB_2882664 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y512 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924