Iright
BRAND / VENDOR: Proteintech

Proteintech, 67426-1-Ig, ERP44 Monoclonal antibody

CATALOG NUMBER: 67426-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ERP44 (67426-1-Ig) by Proteintech is a Monoclonal antibody targeting ERP44 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 67426-1-Ig targets ERP44 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, HEK-293 cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information TXNDC4 is also named as KIAA0573, ERP44, PDIA10, ERp44 and belongs to the thioredoxin family (TRX). It may be involved in electron transport, protein folding, response to unfolded protein, glycoprotein metabolism, secretory pathway. It may have a role in the control of oxidative protein folding in the endoplasmic reticulum. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8818 Product name: Recombinant human ERP44 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 57-406 aa of BC005374 Sequence: WCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL Predict reactive species Full Name: endoplasmic reticulum protein 44 Calculated Molecular Weight: 406 aa, 47 kDa Observed Molecular Weight: 44-47 kDa GenBank Accession Number: BC005374 Gene Symbol: ERP44 Gene ID (NCBI): 23071 RRID: AB_2882665 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BS26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924