Proteintech, 67430-1-Ig, AMPD2 Monoclonal antibody

Size: 20ul / 150ul The AMPD2 (67430-1-Ig) by Proteintech is a Monoclonal antibody targeting AMPD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 67430-1-Ig targets AMPD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, 4T1 cells, HeLa cells, HepG2 cells, L02 cells, Neuro-2a cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Adenosine monophosphate deaminase (AMPD) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. Three AMPDs are present in mammals named AMPD1/2/3. AMPD2 is the main activity present in adult human liver and is widely expressed in non-muscle tissues and cells (PMID: 8526848). AMPD2 has some isoforms with the molecular mass of 88-101 kDa. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8433 Product name: Recombinant human AMPD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 448-798 aa of BC007711 Sequence: LEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ Predict reactive species Full Name: adenosine monophosphate deaminase 2 (isoform L) Calculated Molecular Weight: 879aa,101 kDa; 798aa,92 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC007711 Gene Symbol: AMPD2 Gene ID (NCBI): 271 RRID: AB_2882668 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q01433 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.