Proteintech, 67436-1-Ig, PEX1 Monoclonal antibody

Size: 20ul / 150ul The PEX1 (67436-1-Ig) by Proteintech is a Monoclonal antibody targeting PEX1 in WB, ELISA applications with reactivity to human, mouse, rat samples 67436-1-Ig targets PEX1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, L02 cells, Jurkat cells, THP-1 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Peroxin (PEX) proteins generate and maintain peroxisomes. The peroxin-1 (PEX1) ATPase facilitates the recycling of the peroxisome matrix protein receptor PEX5 and is the most commonly affected peroxin in human peroxisome biogenesis disorders (PMID: 28600347).  PEX1 and PEX6 are the only members of the AAA family (for ATPases associated with diverse cellular) activities implicated in peroxisome biogenesis and are closely related to p97, which functions in endoplasmic reticulum-associated protein degradation to retrotranslocate endoplasmic reticulum proteins to the cytosol (PMID: 9695811; 11740563). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4623 Product name: Recombinant human PEX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 927-1283 aa of BC035575 Sequence: IRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVLSDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPGQKVTLA Predict reactive species Full Name: peroxisomal biogenesis factor 1 Calculated Molecular Weight: 1283 aa, 143 kDa Observed Molecular Weight: 143 kDa GenBank Accession Number: BC035575 Gene Symbol: PEX1 Gene ID (NCBI): 5189 RRID: AB_2882673 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.