Iright
BRAND / VENDOR: Proteintech

Proteintech, 67443-1-Ig, MTH1 Monoclonal antibody

CATALOG NUMBER: 67443-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MTH1 (67443-1-Ig) by Proteintech is a Monoclonal antibody targeting MTH1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 67443-1-Ig targets MTH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: human renal cell carcinoma tissue, mouse testis tissue, human colon cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9802 Product name: Recombinant human NUDT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of BC014618 Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 1 Calculated Molecular Weight: 179aa,20 kDa; 197aa,23 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC014618 Gene Symbol: MTH1 Gene ID (NCBI): 4521 RRID: AB_2882678 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P36639 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924