Proteintech, 67457-1-Ig, ME2 Monoclonal antibody

Size: 20ul / 150ul The ME2 (67457-1-Ig) by Proteintech is a Monoclonal antibody targeting ME2 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 67457-1-Ig targets ME2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, human peripheral blood platelets, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ME2(malic enzyme 2) is also named as NAD-ME and belongs to the malic enzymes family. ME1, ME2 are important for NADPH production, lipogenesis and glutamine metabolism, but ME2 has a more profound effect. ME2 is a genome-coded mitochondrial enzyme that converts malate to pyruvate and is involved in neuronal synthesis of the neurotransmitter γ-aminobutyric acid (GABA)(PMID:15532013). This protein has 2 isoforms produced by alternative splicing with the MW of 65 kDa and 54 kDa. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20741 Product name: Recombinant human ME2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 136-480 aa of BC000147 Sequence: SISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC Predict reactive species Full Name: malic enzyme 2, NAD(+)-dependent, mitochondrial Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 54 kDa, 65 kDa GenBank Accession Number: BC000147 Gene Symbol: ME2 Gene ID (NCBI): 4200 RRID: AB_2882689 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23368 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.