Iright
BRAND / VENDOR: Proteintech

Proteintech, 67465-1-Ig, NAT10 Monoclonal antibody

CATALOG NUMBER: 67465-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NAT10 (67465-1-Ig) by Proteintech is a Monoclonal antibody targeting NAT10 in WB, ELISA applications with reactivity to human, mouse, rat samples 67465-1-Ig targets NAT10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4355 Product name: Recombinant human NAT10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 676-1025 aa of BC035558 Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK Predict reactive species Full Name: N-acetyltransferase 10 (GCN5-related) Calculated Molecular Weight: 1025 aa, 116 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC035558 Gene Symbol: NAT10 Gene ID (NCBI): 55226 RRID: AB_2882694 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H0A0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924