Proteintech, 67477-1-Ig, ERAP2 Monoclonal antibody

Size: 20ul / 150ul The ERAP2 (67477-1-Ig) by Proteintech is a Monoclonal antibody targeting ERAP2 in WB, ELISA applications with reactivity to Human, Rat samples 67477-1-Ig targets ERAP2 in WB, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information ERAP2(Endoplasmic reticulum aminopeptidase 2) is also named as LRAP(Leukocyte-derived arginine aminopeptidase). It plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. ERAP2 can form heterodimers with ERAP1(PMID:15908954). Defects in the expression of ERAP2 may cause improper antigen processing, possibly leading to favor tumor escape from the immune surveillance. ERAP2 has the calculated molecular mass of 105-110 kDa, and apparent molecular mass of 120 kDa duo to the glycosylation. Specification Tested Reactivity: Human, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30061 Product name: Recombinant human ERAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 41-180 aa of BC065240 Sequence: PSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFY Predict reactive species Full Name: endoplasmic reticulum aminopeptidase 2 Calculated Molecular Weight: 110 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC065240 Gene Symbol: ERAP2 Gene ID (NCBI): 64167 RRID: AB_2882704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6P179 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.