Proteintech, 67479-1-Ig, SLC22A7 Monoclonal antibody

Size: 20ul / 150ul The SLC22A7 (67479-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC22A7 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 67479-1-Ig targets SLC22A7 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: SMMC-7721 cells Positive IHC detected in: human liver tissue, human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Organic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25234 Product name: Recombinant human SLC22A7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 42-140 aa of BC033805 Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ Predict reactive species Full Name: solute carrier family 22 (organic anion transporter), member 7 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC033805 Gene Symbol: SLC22A7 Gene ID (NCBI): 10864 RRID: AB_2882706 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.